SCOPe 2.08: Domain d3qn9a1: 3qn9 A:3-119

Lineage for d3qn9a1 (3qn9 A:3-119)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.0: automated matches [227243] (1 protein)
   not a true family

6. Protein automated matches [227009] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [230194] (6 PDB entries)

8. Domain d3qn9a1: 3qn9 A:3-119 [233342]
   Other proteins in same PDB: d3qn9a2
   automated match to d3qn0a_
   complexed with zn

Details for d3qn9a1

PDB Entry: 3qn9, 2.93 Å

PDB Description: crystal structure of a 6-pyruvoyltetrahydropterin synthase homologue from esherichia coli

PDB Compounds: (A:) 6-pyruvoyl tetrahydrobiopterin synthase

SCOPe Domain Sequences for d3qn9a1:

Sequence; same for both SEQRES and ATOM records:

>d3qn9a1 d.96.1.0 (A:3-119) automated matches {Escherichia coli [TaxId: 469008]}
sttlfkdftfeaahrlphvpeghkcgrlhghsfmvrleitgevdphtgwiidfaelkaaf
kptyerldhhylndipglenptsevlakwiwdqvkpvvpllsavmvketctagciyr

Timeline for d3qn9a1:

• d3qn9a1 first appeared in SCOPe 2.03, called d3qn9a_
  
• d3qn9a1 was called d3qn9a_ in SCOPe 2.07