Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.0: automated matches [227239] (1 protein) not a true family |
Protein automated matches [226999] (2 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries) |
Domain d3qjtb1: 3qjt B:3-36 [233335] Other proteins in same PDB: d3qjta_, d3qjtb2, d3qjtc_ automated match to d2qpdb2 complexed with cmo, cu1, cua, has, hem |
PDB Entry: 3qjt (more details), 2.95 Å
SCOPe Domain Sequences for d3qjtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjtb1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dqhkahkailayekgwlafslamlfvfialiayt
Timeline for d3qjtb1: