SCOPe 2.03: Domain d3qjtb1: 3qjt B:3-36

Lineage for d3qjtb1 (3qjt B:3-36)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.0: automated matches [227239] (1 protein)
   not a true family

6. Protein automated matches [226999] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [225642] (4 PDB entries)

8. Domain d3qjtb1: 3qjt B:3-36 [233335]
   Other proteins in same PDB: d3qjta_, d3qjtb2, d3qjtc_
   automated match to d2qpdb2
   complexed with cmo, cu1, cua, has, hem

Details for d3qjtb1

PDB Entry: 3qjt, 2.95 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3qjtb1:

Sequence; same for both SEQRES and ATOM records:

>d3qjtb1 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus [TaxId: 300852]}
dqhkahkailayekgwlafslamlfvfialiayt

Timeline for d3qjtb1:

• d3qjtb1 is new in SCOPe 2.03-stable
  
• d3qjtb1 appears in SCOPe 2.04
  
• d3qjtb1 appears in the current release, SCOPe 2.08