Lineage for d3qjsb2 (3qjs B:37-168)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303168Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1303169Protein Cytochrome c oxidase [49544] (4 species)
  7. 1303234Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (25 PDB entries)
  8. 1303251Domain d3qjsb2: 3qjs B:37-168 [233334]
    Other proteins in same PDB: d3qjsa_, d3qjsb1, d3qjsc_
    automated match to d2qpeb1
    complexed with cmo, cu1, cua, has, hem

Details for d3qjsb2

PDB Entry: 3qjs (more details), 2.8 Å

PDB Description: the structure of and photolytic induced changes of carbon monoxide binding to the cytochrome ba3-oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3qjsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjsb2 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

SCOPe Domain Coordinates for d3qjsb2:

Click to download the PDB-style file with coordinates for d3qjsb2.
(The format of our PDB-style files is described here.)

Timeline for d3qjsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qjsb1