Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) |
Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
Protein automated matches [190672] (32 species) not a true protein |
Species Desulfitobacterium hafniense [TaxId:272564] [233297] (1 PDB entry) |
Domain d3pxvd1: 3pxv D:1-188 [233301] Other proteins in same PDB: d3pxvb2, d3pxvd2 automated match to d3eo8f_ complexed with fmn |
PDB Entry: 3pxv (more details), 2.3 Å
SCOPe Domain Sequences for d3pxvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pxvd1 d.90.1.0 (D:1-188) automated matches {Desulfitobacterium hafniense [TaxId: 272564]} mmnetlkviaeryscrdfknempsdellqaiaeaaiqapsgmnrqawrvivvknkelmqe meaeglaylagmedqssynrimerggrlfygapcmivvpidptqygpalvdcgilcqtia laatslgianimcgytglafasglraeefskrlgfpegyafgcsvllghanttkpphvpd kdkityve
Timeline for d3pxvd1:
View in 3D Domains from other chains: (mouse over for more information) d3pxva_, d3pxvb1, d3pxvb2, d3pxvc_ |