SCOPe 2.08: Domain d3pxvd1: 3pxv D:1-188

Lineage for d3pxvd1 (3pxv D:1-188)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
   core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243

4. Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families)

5. Family d.90.1.0: automated matches [191446] (1 protein)
   not a true family

6. Protein automated matches [190672] (32 species)
   not a true protein

7. Species Desulfitobacterium hafniense [TaxId:272564] [233297] (1 PDB entry)

8. Domain d3pxvd1: 3pxv D:1-188 [233301]
   Other proteins in same PDB: d3pxvb2, d3pxvd2
   automated match to d3eo8f_
   complexed with fmn

Details for d3pxvd1

PDB Entry: 3pxv, 2.3 Å

PDB Description: Crystal structure of a Nitroreductase with bound FMN (Dhaf_2018) from Desulfitobacterium hafniense DCB-2 at 2.30 A resolution

PDB Compounds: (D:) Nitroreductase

SCOPe Domain Sequences for d3pxvd1:

Sequence; same for both SEQRES and ATOM records:

>d3pxvd1 d.90.1.0 (D:1-188) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
mmnetlkviaeryscrdfknempsdellqaiaeaaiqapsgmnrqawrvivvknkelmqe
meaeglaylagmedqssynrimerggrlfygapcmivvpidptqygpalvdcgilcqtia
laatslgianimcgytglafasglraeefskrlgfpegyafgcsvllghanttkpphvpd
kdkityve

Timeline for d3pxvd1:

• d3pxvd1 first appeared in SCOPe 2.03, called d3pxvd_
  
• d3pxvd1 appears in SCOPe 2.07