Lineage for d3pwib1 (3pwi B:6-137)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413099Species Escherichia coli [TaxId:444449] [233278] (2 PDB entries)
  8. 1413105Domain d3pwib1: 3pwi B:6-137 [233289]
    Other proteins in same PDB: d3pwia2, d3pwib2
    automated match to d1ec7a2
    complexed with glr, gol, mg; mutant

Details for d3pwib1

PDB Entry: 3pwi (more details), 2.23 Å

PDB Description: Crystal structure of the mutant P34A of D-Glucarate dehydratase from Escherichia coli complexed with product 5-keto-4-deoxy-D-Glucarate
PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d3pwib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwib1 d.54.1.0 (B:6-137) automated matches {Escherichia coli [TaxId: 444449]}
ttpvvtemqvipvaghdsmlmnlsgahaafftrniviikdnsghtgvgeipggekirktl
edaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldllg
qhlgvnvasllg

SCOPe Domain Coordinates for d3pwib1:

Click to download the PDB-style file with coordinates for d3pwib1.
(The format of our PDB-style files is described here.)

Timeline for d3pwib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pwib2