Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Escherichia coli [TaxId:444449] [233278] (2 PDB entries) |
Domain d3pwib1: 3pwi B:6-137 [233289] Other proteins in same PDB: d3pwia2, d3pwib2 automated match to d1ec7a2 complexed with glr, gol, mg; mutant |
PDB Entry: 3pwi (more details), 2.23 Å
SCOPe Domain Sequences for d3pwib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwib1 d.54.1.0 (B:6-137) automated matches {Escherichia coli [TaxId: 444449]} ttpvvtemqvipvaghdsmlmnlsgahaafftrniviikdnsghtgvgeipggekirktl edaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldllg qhlgvnvasllg
Timeline for d3pwib1: