Lineage for d3pwgc1 (3pwg C:4-137)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191860Species Escherichia coli [TaxId:444449] [233278] (2 PDB entries)
  8. 2191863Domain d3pwgc1: 3pwg C:4-137 [233287]
    Other proteins in same PDB: d3pwga2, d3pwgb2, d3pwgd2
    automated match to d1ec7a2
    complexed with glr, gol, mg; mutant

Details for d3pwgc1

PDB Entry: 3pwg (more details), 2 Å

PDB Description: Crystal structure of the mutant S29G.P34A of D-Glucarate dehydratase from Escherichia coli complexed with product 5-keto-4-deoxy-D-Glucarate
PDB Compounds: (C:) glucarate dehydratase

SCOPe Domain Sequences for d3pwgc1:

Sequence, based on SEQRES records: (download)

>d3pwgc1 d.54.1.0 (C:4-137) automated matches {Escherichia coli [TaxId: 444449]}
qfttpvvtemqvipvaghdsmlmnlggahaafftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
lgqhlgvnvasllg

Sequence, based on observed residues (ATOM records): (download)

>d3pwgc1 d.54.1.0 (C:4-137) automated matches {Escherichia coli [TaxId: 444449]}
qfttpvvtemqvipvaghdsmlmnlggahaafftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdlrttihvvtgieaamldllgqhlgvnva
sllg

SCOPe Domain Coordinates for d3pwgc1:

Click to download the PDB-style file with coordinates for d3pwgc1.
(The format of our PDB-style files is described here.)

Timeline for d3pwgc1: