Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
Protein automated matches [226997] (11 species) not a true protein |
Species Escherichia coli [TaxId:444449] [233282] (2 PDB entries) |
Domain d3pwgb2: 3pwg B:138-446 [233283] Other proteins in same PDB: d3pwga1, d3pwgb1, d3pwgc1, d3pwgd1 automated match to d1ec7a1 complexed with glr, gol, mg; mutant |
PDB Entry: 3pwg (more details), 2 Å
SCOPe Domain Sequences for d3pwgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pwgb2 c.1.11.2 (B:138-446) automated matches {Escherichia coli [TaxId: 444449]} dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf dnkrpcmvr
Timeline for d3pwgb2: