SCOPe 2.04: Domain d3pwga1: 3pwg A:5-137

Lineage for d3pwga1 (3pwg A:5-137)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Escherichia coli [TaxId:444449] [233278] (2 PDB entries)

8. Domain d3pwga1: 3pwg A:5-137 [233281]
   Other proteins in same PDB: d3pwga2, d3pwgb2, d3pwgd2
   automated match to d1ec7a2
   complexed with glr, gol, mg; mutant

Details for d3pwga1

PDB Entry: 3pwg, 2 Å

PDB Description: Crystal structure of the mutant S29G.P34A of D-Glucarate dehydratase from Escherichia coli complexed with product 5-keto-4-deoxy-D-Glucarate

PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3pwga1:

Sequence; same for both SEQRES and ATOM records:

>d3pwga1 d.54.1.0 (A:5-137) automated matches {Escherichia coli [TaxId: 444449]}
fttpvvtemqvipvaghdsmlmnlggahaafftrniviikdnsghtgvgeipggekirkt
ledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldll
gqhlgvnvasllg

Timeline for d3pwga1:

• d3pwga1 first appeared in SCOPe 2.03
  
• d3pwga1 appears in SCOPe 2.05
  
• d3pwga1 appears in the current release, SCOPe 2.08