SCOPe 2.06: Domain d3puia2: 3pui A:352-574

Lineage for d3puia2 (3pui A:352-574)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (37 species)
   not a true protein

7. Species Rhodococcus sp. [TaxId:104109] [232531] (9 PDB entries)

8. Domain d3puia2: 3pui A:352-574 [233271]
   Other proteins in same PDB: d3puia1, d3puia3
   automated match to d1ju3a1
   complexed with cl, na; mutant

Details for d3puia2

PDB Entry: 3pui, 1.53 Å

PDB Description: cocaine esterase with mutations g4c, s10c

PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3puia2:

Sequence; same for both SEQRES and ATOM records:

>d3puia2 b.18.1.0 (A:352-574) automated matches {Rhodococcus sp. [TaxId: 104109]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr

Timeline for d3puia2:

• d3puia2 first appeared in SCOPe 2.03
  
• d3puia2 appears in SCOPe 2.05
  
• d3puia2 appears in SCOPe 2.07
  
• d3puia2 appears in the current release, SCOPe 2.08