SCOPe 2.05: Domain d3pmea1: 3pme A:868-1085

Lineage for d3pmea1 (3pme A:868-1085)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (21 PDB entries)

8. Domain d3pmea1: 3pme A:868-1085 [233258]
   Other proteins in same PDB: d3pmea2
   automated match to d3btaa1
   complexed with gol, so4

Details for d3pmea1

PDB Entry: 3pme, 1.56 Å

PDB Description: Crystal structure of the receptor binding domain of botulinum neurotoxin C/D mosaic serotype

PDB Compounds: (A:) Type C neurotoxin

SCOPe Domain Sequences for d3pmea1:

Sequence; same for both SEQRES and ATOM records:

>d3pmea1 b.29.1.0 (A:868-1085) automated matches {Clostridium botulinum [TaxId: 1491]}
indskilslqnkknalvdtsgynaevrlegdvqvntiytndfklsssgdkiivnlnnnil
ysaiyenssvsfwikiskdltnshneytiinsikqnsgwklcirngniewilqdinrkyk
slifdyseslshtgytnkwffvtitnnimgymklyingelkqseriedldevkldktivf
gidenidenqmlwirdfnifskelsnedinivyegqil

Timeline for d3pmea1:

• d3pmea1 first appeared in SCOPe 2.03
  
• d3pmea1 appears in SCOPe 2.04
  
• d3pmea1 appears in SCOPe 2.06
  
• d3pmea1 appears in the current release, SCOPe 2.08