SCOPe 2.08: Domain d3pk2a1: 3pk2 A:14-134

Lineage for d3pk2a1 (3pk2 A:14-134)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d3pk2a1: 3pk2 A:14-134 [233257]
   Other proteins in same PDB: d3pk2a2
   automated match to d4bx5a_
   complexed with 4ir, ir3

Details for d3pk2a1

PDB Entry: 3pk2, 1.9 Å

PDB Description: Artificial Transfer Hydrogenases for the Enantioselective Reduction of Cyclic Imines

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3pk2a1:

Sequence; same for both SEQRES and ATOM records:

>d3pk2a1 b.61.1.1 (A:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltagtteanawkstlvghdtftkv
k

Timeline for d3pk2a1:

• d3pk2a1 first appeared in SCOPe 2.03, called d3pk2a_
  
• d3pk2a1 appears in SCOPe 2.07