Lineage for d3pdue2 (3pdu E:164-287)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498032Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1498033Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1498233Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1498234Protein automated matches [226851] (26 species)
    not a true protein
  7. 1498283Species Geobacter sulfurreducens [TaxId:35554] [233220] (1 PDB entry)
  8. 1498288Domain d3pdue2: 3pdu E:164-287 [233228]
    Other proteins in same PDB: d3pdua1, d3pdub1, d3pduc1, d3pdud1, d3pdue1, d3pduf1, d3pdug1, d3pduh1
    automated match to d2i9pa2
    complexed with gol, nap

Details for d3pdue2

PDB Entry: 3pdu (more details), 1.89 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+
PDB Compounds: (E:) 3-hydroxyisobutyrate dehydrogenase family protein

SCOPe Domain Sequences for d3pdue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pdue2 a.100.1.0 (E:164-287) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
vgqgarmklvvnmimgqmmtalgegmalgrncgldggqllevldagamanpmfkgkgqml
lsgefptsfplkhmqkdlrlavelgdrlgqplhgaatanesfkraraaghadedfaavfr
vlea

SCOPe Domain Coordinates for d3pdue2:

Click to download the PDB-style file with coordinates for d3pdue2.
(The format of our PDB-style files is described here.)

Timeline for d3pdue2: