Class a: All alpha proteins [46456] (285 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (26 species) not a true protein |
Species Geobacter sulfurreducens [TaxId:35554] [233220] (1 PDB entry) |
Domain d3pdub2: 3pdu B:164-287 [233225] Other proteins in same PDB: d3pdua1, d3pdub1, d3pduc1, d3pdud1, d3pdue1, d3pduf1, d3pdug1, d3pduh1 automated match to d2i9pa2 complexed with gol, nap |
PDB Entry: 3pdu (more details), 1.89 Å
SCOPe Domain Sequences for d3pdub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pdub2 a.100.1.0 (B:164-287) automated matches {Geobacter sulfurreducens [TaxId: 35554]} vgqgarmklvvnmimgqmmtalgegmalgrncgldggqllevldagamanpmfkgkgqml lsgefptsfplkhmqkdlrlavelgdrlgqplhgaatanesfkraraaghadedfaavfr vlea
Timeline for d3pdub2: