SCOPe 2.04: Domain d3pdub2: 3pdu B:164-287

Lineage for d3pdub2 (3pdu B:164-287)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [233220] (1 PDB entry)

8. Domain d3pdub2: 3pdu B:164-287 [233225]
   Other proteins in same PDB: d3pdua1, d3pdub1, d3pduc1, d3pdud1, d3pdue1, d3pduf1, d3pdug1, d3pduh1
   automated match to d2i9pa2
   complexed with gol, nap

Details for d3pdub2

PDB Entry: 3pdu, 1.89 Å

PDB Description: crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with nadp+

PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase family protein

SCOPe Domain Sequences for d3pdub2:

Sequence; same for both SEQRES and ATOM records:

>d3pdub2 a.100.1.0 (B:164-287) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
vgqgarmklvvnmimgqmmtalgegmalgrncgldggqllevldagamanpmfkgkgqml
lsgefptsfplkhmqkdlrlavelgdrlgqplhgaatanesfkraraaghadedfaavfr
vlea

Timeline for d3pdub2:

• d3pdub2 first appeared in SCOPe 2.03
  
• d3pdub2 appears in SCOPe 2.05
  
• d3pdub2 appears in the current release, SCOPe 2.08