Lineage for d1qjzc_ (1qjz C:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) 
Protein PHMV coat protein [49641] (1 species) Species Physalis mottle virus [TaxId:72539] [49642] (1 PDB entry) 
Domain d1qjzc_: 1qjz C: [23316]
Details for d1qjzc_
PDB Entry: 1qjz (more details), 3.8 Å
PDB Description: three dimensional structure of physalis mottle virus : implications for the viral assembly
SCOP Domain Sequences for d1qjzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qjzc_ b.10.1.2 (C:) PHMV coat protein {Physalis mottle virus}
mdssevvkvkqasipapgsilsqpnteqspaivlpfqfeattfgtaetaaqvslqtadpi
tkltapyrhaqiveckailtptdlavsnpltvylawvpanspatptqilrvyggqsfvlg
gaisaaktievplnldsvnrmlkdsvtytdtpkllaysraptnpskiptasiqisgrirl
skpmlian
SCOP Domain Coordinates for d1qjzc_:
Click to download the PDB-style file with coordinates for d1qjzc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qjzc_:
- d1qjzc_ appears in SCOP 1.57
- d1qjzc_ appears in the current release, SCOPe 2.08
View in 3D
