SCOPe 2.08: Domain d3p91a1: 3p91 A:1-127

Lineage for d3p91a1 (3p91 A:1-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [233155] (1 PDB entry)

8. Domain d3p91a1: 3p91 A:1-127 [233156]
   automated match to d1plqa1

Details for d3p91a1

PDB Entry: 3p91, 2.4 Å

PDB Description: crystal structure of proliferating cellular nuclear antigen from entamoeba histolytica

PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3p91a1:

Sequence, based on SEQRES records:

>d3p91a1 d.131.1.0 (A:1-127) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mcafhakfkeaalfkrvveslkstidktnfdcsdagiavqcmdnshvslvsllietdafd
efqclkpitlginlthlskilkaldndcglildvkkvddavlsitsegtnktmkfglnlv
dieaesv

Sequence, based on observed residues (ATOM records):

>d3p91a1 d.131.1.0 (A:1-127) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mcafhakfkeaalfkrvveslkstidktnfdcsdagiavqcmdnshvslvsllietdafd
efqclkpitlginlthlskilkaldndcglildvkkvddavlsitsenktmkfglnlvdi
eaesv

Timeline for d3p91a1:

• d3p91a1 first appeared in SCOPe 2.03
  
• d3p91a1 appears in SCOPe 2.07