Lineage for d3osfd2 (3osf D:97-150)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982467Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982468Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982595Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries)
  8. 1982603Domain d3osfd2: 3osf D:97-150 [233128]
    automated match to d1gv2a2
    protein/DNA complex; complexed with ipa

Details for d3osfd2

PDB Entry: 3osf (more details), 2.03 Å

PDB Description: The structure of protozoan parasite Trichomonas vaginalis Myb2 in complex with MRE-2f-13 DNA
PDB Compounds: (D:) myb21

SCOPe Domain Sequences for d3osfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3osfd2 a.4.1.0 (D:97-150) automated matches {Trichomonas vaginalis [TaxId: 5722]}
sishtpwtaeedallvqkiqeygrqwaiiakffpgrtdihiknrwvtisnklgi

SCOPe Domain Coordinates for d3osfd2:

Click to download the PDB-style file with coordinates for d3osfd2.
(The format of our PDB-style files is described here.)

Timeline for d3osfd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3osfd1