SCOP 1.63: Domain d1auyb_: 1auy B:

Lineage for d1auyb_ (1auy B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (18 proteins)

6. Protein TYMV coat protein [49639] (1 species)

7. Species Turnip yellow mosaic virus [TaxId:12154] [49640] (1 PDB entry)

8. Domain d1auyb_: 1auy B: [23312]

Details for d1auyb_

PDB Entry: 1auy, 3.2 Å

PDB Description: turnip yellow mosaic virus

SCOP Domain Sequences for d1auyb_:

Sequence; same for both SEQRES and ATOM records:

>d1auyb_ b.10.1.2 (B:) TYMV coat protein {Turnip yellow mosaic virus}
meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
splitdtst

Timeline for d1auyb_:

• d1auyb_ first appeared (with stable ids) in SCOP 1.55
  
• d1auyb_ appears in SCOP 1.61
  
• d1auyb_ appears in SCOP 1.65
  
• d1auyb_ appears in the current release, SCOPe 2.08