Lineage for d3ooja1 (3ooj A:1-240)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1439841Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1439842Protein automated matches [190509] (8 species)
    not a true protein
  7. 1439871Species Escherichia coli [TaxId:562] [233107] (1 PDB entry)
  8. 1439872Domain d3ooja1: 3ooj A:1-240 [233113]
    Other proteins in same PDB: d3ooja2, d3oojb2, d3oojc2
    automated match to d4amva2
    complexed with g6p, g6q, glu, gol; mutant

Details for d3ooja1

PDB Entry: 3ooj (more details), 2.5 Å

PDB Description: c1a mutant of e. coli glms in complex with glucose-6p and glutamate
PDB Compounds: (A:) Glucosamine/fructose-6-phosphate aminotransferase, isomerizing

SCOPe Domain Sequences for d3ooja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ooja1 d.153.1.0 (A:1-240) automated matches {Escherichia coli [TaxId: 562]}
agivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOPe Domain Coordinates for d3ooja1:

Click to download the PDB-style file with coordinates for d3ooja1.
(The format of our PDB-style files is described here.)

Timeline for d3ooja1: