Lineage for d3om3b2 (3om3 B:130-285)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303168Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1303267Protein automated matches [233094] (1 species)
    not a true protein
  7. 1303268Species Rhodobacter sphaeroides [TaxId:272943] [233095] (1 PDB entry)
  8. 1303269Domain d3om3b2: 3om3 B:130-285 [233098]
    Other proteins in same PDB: d3om3a_, d3om3b1, d3om3c_, d3om3d1
    automated match to d1m56b1
    complexed with ca, cd, cu1, dmu, hea, hth, mg, trd; mutant

Details for d3om3b2

PDB Entry: 3om3 (more details), 2.6 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation in the reduced state
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3om3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3om3b2 b.6.1.2 (B:130-285) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleqhhhh

SCOPe Domain Coordinates for d3om3b2:

Click to download the PDB-style file with coordinates for d3om3b2.
(The format of our PDB-style files is described here.)

Timeline for d3om3b2: