SCOPe 2.05: Domain d3om3b1: 3om3 B:30-129

Lineage for d3om3b1 (3om3 B:30-129)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein automated matches [233090] (1 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:272943] [233091] (4 PDB entries)

8. Domain d3om3b1: 3om3 B:30-129 [233097]
   Other proteins in same PDB: d3om3a_, d3om3b2, d3om3c_, d3om3d2
   automated match to d3dtub2
   complexed with ca, cd, cu1, dmu, hea, hth, mg, trd; mutant

Details for d3om3b1

PDB Entry: 3om3, 2.6 Å

PDB Description: catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation in the reduced state

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3om3b1:

Sequence; same for both SEQRES and ATOM records:

>d3om3b1 f.17.2.1 (B:30-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk
vparfthnspleiawtivpivilvaigafslpvlfnqqei

Timeline for d3om3b1:

• d3om3b1 first appeared in SCOPe 2.03
  
• d3om3b1 appears in SCOPe 2.04
  
• d3om3b1 appears in SCOPe 2.06
  
• d3om3b1 appears in the current release, SCOPe 2.08