Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein automated matches [233090] (1 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:272943] [233091] (6 PDB entries) |
Domain d3om3d1: 3om3 D:30-129 [233093] Other proteins in same PDB: d3om3a_, d3om3b2, d3om3b3, d3om3c_, d3om3d2, d3om3d3 automated match to d3dtub2 complexed with ca, cd, cu1, dmu, hea, hth, mg, trd; mutant |
PDB Entry: 3om3 (more details), 2.6 Å
SCOPe Domain Sequences for d3om3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3om3d1 f.17.2.1 (D:30-129) automated matches {Rhodobacter sphaeroides [TaxId: 272943]} leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtllilyavwrfhekrnk vparfthnspleiawtivpivilvaigafslpvlfnqqei
Timeline for d3om3d1: