Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [233085] (1 PDB entry) |
Domain d3of1a2: 3of1 A:294-416 [233087] automated match to d1cx4a2 complexed with cmp |
PDB Entry: 3of1 (more details), 2.21 Å
SCOPe Domain Sequences for d3of1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3of1a2 b.82.3.0 (A:294-416) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ddllksmpvlkslttydrakladaldtkiyqpgetiiregdqgenfylieygavdvskkg qgvinklkdhdyfgevallndlprqatvtatkrtkvatlgksgfqrllgpavdvlklndp trh
Timeline for d3of1a2: