SCOPe 2.03: Domain d3of1a1: 3of1 A:171-293

Lineage for d3of1a1 (3of1 A:171-293)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (8 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:4932] [233085] (1 PDB entry)

8. Domain d3of1a1: 3of1 A:171-293 [233086]
   automated match to d1cx4a1
   complexed with cmp

Details for d3of1a1

PDB Entry: 3of1, 2.21 Å

PDB Description: Crystal Structure of Bcy1, the Yeast Regulatory Subunit of PKA

PDB Compounds: (A:) cAMP-dependent protein kinase regulatory subunit

SCOPe Domain Sequences for d3of1a1:

Sequence; same for both SEQRES and ATOM records:

>d3of1a1 b.82.3.0 (A:171-293) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
qlqrleksirnnflfnkldsdskrlvincleeksvpkgatiikqgdqgdyfyvvekgtvd
fyvndnkvnssgpgssfgelalmynspraatvvatsdcllwaldrltfrkillgssfkkr
lmy

Timeline for d3of1a1:

• d3of1a1 is new in SCOPe 2.03-stable
  
• d3of1a1 appears in SCOPe 2.04
  
• d3of1a1 appears in the current release, SCOPe 2.08