SCOPe 2.06: Domain d3odoa2: 3odo A:624-761

Lineage for d3odoa2 (3odo A:624-761)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)

8. Domain d3odoa2: 3odo A:624-761 [233081]
   Other proteins in same PDB: d3odoa1, d3odoa3, d3odob1, d3odob3
   automated match to d1xcga2

Details for d3odoa2

PDB Entry: 3odo, 2.9 Å

PDB Description: Crystal Structure of the DH/PH Domains of p115-RhoGEF

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d3odoa2:

Sequence; same for both SEQRES and ATOM records:

>d3odoa2 b.55.1.0 (A:624-761) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lshlrqssdpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqde
rlllkshsrtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaq
tvserknwcalitetags

Timeline for d3odoa2:

• d3odoa2 first appeared in SCOPe 2.03
  
• d3odoa2 appears in SCOPe 2.05
  
• d3odoa2 appears in SCOPe 2.07
  
• d3odoa2 appears in the current release, SCOPe 2.08