SCOP 1.65: Domain d1cwpb_: 1cwp B:

Lineage for d1cwpb_ (1cwp B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families)

5. Family b.121.4.5: Bromoviridae-like VP [88639] (1 protein)

6. Protein Cucumovirus coat protein [88640] (4 species)

7. Species Cowpea chlorotic mottle virus [TaxId:12303] [49636] (1 PDB entry)

8. Domain d1cwpb_: 1cwp B: [23306]

Details for d1cwpb_

PDB Entry: 1cwp, 3.2 Å

PDB Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy

SCOP Domain Sequences for d1cwpb_:

Sequence; same for both SEQRES and ATOM records:

>d1cwpb_ b.121.4.5 (B:) Cucumovirus coat protein {Cowpea chlorotic mottle virus}
vvqpvivepiasgqgkaikawtgysvskwtascaaaeakvtsaitislpnelssernkql
kvgrvllwlgllpsvsgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgit
leqlaadltiylyssaaltegdvivhlevehvrptfddsftpvy

Timeline for d1cwpb_:

• d1cwpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwpb_ appears in SCOP 1.63
  
• d1cwpb_ appears in SCOP 1.67
  
• d1cwpb_ appears in the current release, SCOPe 2.08