SCOPe 2.06: Domain d3o2da1: 3o2d A:1-97

Lineage for d3o2da1 (3o2d A:1-97)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (32 PDB entries)

8. Domain d3o2da1: 3o2d A:1-97 [233059]
   Other proteins in same PDB: d3o2da2, d3o2dl1, d3o2dl2
   automated match to d3cd4a1

Details for d3o2da1

PDB Entry: 3o2d, 2.19 Å

PDB Description: Crystal structure of HIV-1 primary receptor CD4 in complex with a potent antiviral antibody

PDB Compounds: (A:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d3o2da1:

Sequence; same for both SEQRES and ATOM records:

>d3o2da1 b.1.1.1 (A:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d3o2da1:

• d3o2da1 first appeared in SCOPe 2.03
  
• d3o2da1 appears in SCOPe 2.05
  
• d3o2da1 appears in SCOPe 2.07
  
• d3o2da1 appears in the current release, SCOPe 2.08