Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (32 PDB entries) |
Domain d3o2da1: 3o2d A:1-97 [233059] Other proteins in same PDB: d3o2da2, d3o2dl1, d3o2dl2 automated match to d3cd4a1 |
PDB Entry: 3o2d (more details), 2.19 Å
SCOPe Domain Sequences for d3o2da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o2da1 b.1.1.1 (A:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d3o2da1: