Class b: All beta proteins [48724] (119 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll variations: some members have additional 1-2 strands |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.2: Plant virus proteins [49616] (18 proteins) |
Protein Cowpea chlorotic mottle virus [49635] (1 species) |
Species Host: cowpea (Vigna unguiculta), (L.) [49636] (1 PDB entry) |
Domain d1cwpa_: 1cwp A: [23305] |
PDB Entry: 1cwp (more details), 3.2 Å
SCOP Domain Sequences for d1cwpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwpa_ b.10.1.2 (A:) Cowpea chlorotic mottle virus {Host: cowpea (Vigna unguiculta), (L.)} kaikawtgysvskwtascaaaeakvtsaitislpnelssernkqlkvgrvllwlgllpsv sgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgitleqlaadltiylyss aaltegdvivhlevehvrptfddsftpvy
Timeline for d1cwpa_: