Lineage for d1cwpa_ (1cwp A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225197Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
    variations: some members have additional 1-2 strands
  4. 225198Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 225215Family b.10.1.2: Plant virus proteins [49616] (18 proteins)
  6. 225235Protein Cowpea chlorotic mottle virus [49635] (1 species)
  7. 225236Species Host: cowpea (Vigna unguiculta), (L.) [49636] (1 PDB entry)
  8. 225237Domain d1cwpa_: 1cwp A: [23305]

Details for d1cwpa_

PDB Entry: 1cwp (more details), 3.2 Å

PDB Description: structures of the native and swollen forms of cowpea chlorotic mottle virus determined by x-ray crystallography and cryo-electron microscopy

SCOP Domain Sequences for d1cwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwpa_ b.10.1.2 (A:) Cowpea chlorotic mottle virus {Host: cowpea (Vigna unguiculta), (L.)}
kaikawtgysvskwtascaaaeakvtsaitislpnelssernkqlkvgrvllwlgllpsv
sgtvkscvtetqttaaasfqvalavadnskdvvaamypeafkgitleqlaadltiylyss
aaltegdvivhlevehvrptfddsftpvy

SCOP Domain Coordinates for d1cwpa_:

Click to download the PDB-style file with coordinates for d1cwpa_.
(The format of our PDB-style files is described here.)

Timeline for d1cwpa_: