SCOPe 2.03: Domain d3nfpi2: 3nfp I:101-164

Lineage for d3nfpi2 (3nfp I:101-164)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Interleukin-2 receptor alpha chain [144117] (1 species)
   consists of two segment-swapped SCR domains

7. Species Human (Homo sapiens) [TaxId:9606] [144118] (4 PDB entries)
   Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85

8. Domain d3nfpi2: 3nfp I:101-164 [233026]
   automated match to d2erja1

Details for d3nfpi2

PDB Entry: 3nfp, 2.86 Å

PDB Description: Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with IL-2Ra (CD25) ectodomain

PDB Compounds: (I:) Interleukin-2 receptor subunit alpha

SCOPe Domain Sequences for d3nfpi2:

Sequence; same for both SEQRES and ATOM records:

>d3nfpi2 g.18.1.1 (I:101-164) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
pghcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqpq
lict

Timeline for d3nfpi2:

• d3nfpi2 is new in SCOPe 2.03-stable
  
• d3nfpi2 appears in SCOPe 2.04
  
• d3nfpi2 appears in the current release, SCOPe 2.08