SCOPe 2.05: Domain d3nfpk1: 3nfp K:1-64

Lineage for d3nfpk1 (3nfp K:1-64)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Interleukin-2 receptor alpha chain [144117] (1 species)
   consists of two segment-swapped SCR domains

7. Species Human (Homo sapiens) [TaxId:9606] [144118] (4 PDB entries)
   Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85

8. Domain d3nfpk1: 3nfp K:1-64 [233025]
   Other proteins in same PDB: d3nfpb1, d3nfpb2, d3nfpl1, d3nfpl2
   automated match to d2erja2

Details for d3nfpk1

PDB Entry: 3nfp, 2.86 Å

PDB Description: Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with IL-2Ra (CD25) ectodomain

PDB Compounds: (K:) Interleukin-2 receptor subunit alpha

SCOPe Domain Sequences for d3nfpk1:

Sequence, based on SEQRES records:

>d3nfpk1 g.18.1.1 (K:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgnsshsswdnqcq
ctss

Sequence, based on observed residues (ATOM records):

>d3nfpk1 g.18.1.1 (K:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlncecriksgslymlctgnsshsswdnqcqctss

Timeline for d3nfpk1:

• d3nfpk1 first appeared in SCOPe 2.03
  
• d3nfpk1 appears in SCOPe 2.04
  
• d3nfpk1 appears in SCOPe 2.06
  
• d3nfpk1 appears in the current release, SCOPe 2.08