Lineage for d3nfpk1 (3nfp K:1-64)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585277Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2585278Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2585279Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2585514Protein Interleukin-2 receptor alpha chain [144117] (1 species)
    consists of two segment-swapped SCR domains
  7. 2585515Species Human (Homo sapiens) [TaxId:9606] [144118] (4 PDB entries)
    Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85
  8. 2585526Domain d3nfpk1: 3nfp K:1-64 [233025]
    Other proteins in same PDB: d3nfpb1, d3nfpb2, d3nfpl1, d3nfpl2
    automated match to d2erja2

Details for d3nfpk1

PDB Entry: 3nfp (more details), 2.86 Å

PDB Description: Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with IL-2Ra (CD25) ectodomain
PDB Compounds: (K:) Interleukin-2 receptor subunit alpha

SCOPe Domain Sequences for d3nfpk1:

Sequence, based on SEQRES records: (download)

>d3nfpk1 g.18.1.1 (K:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlnceckrgfrriksgslymlctgnsshsswdnqcq
ctss

Sequence, based on observed residues (ATOM records): (download)

>d3nfpk1 g.18.1.1 (K:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
elcdddppeiphatfkamaykegtmlncecriksgslymlctgnsshsswdnqcqctss

SCOPe Domain Coordinates for d3nfpk1:

Click to download the PDB-style file with coordinates for d3nfpk1.
(The format of our PDB-style files is described here.)

Timeline for d3nfpk1: