Lineage for d3ncfb1 (3ncf B:1-100)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2036143Protein automated matches [190888] (1 species)
    not a true protein
  7. 2036144Species Human (Homo sapiens) [TaxId:9606] [188282] (30 PDB entries)
  8. 2036173Domain d3ncfb1: 3ncf B:1-100 [232999]
    Other proteins in same PDB: d3ncfa_
    automated match to d3d48r1
    complexed with cl, na; mutant

Details for d3ncfb1

PDB Entry: 3ncf (more details), 2.8 Å

PDB Description: a mutant human prolactin receptor antagonist h30a in complex with the mutant extracellular domain h188a of the human prolactin receptor
PDB Compounds: (B:) Prolactin receptor

SCOPe Domain Sequences for d3ncfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncfb1 b.1.2.1 (B:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn
schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyi

SCOPe Domain Coordinates for d3ncfb1:

Click to download the PDB-style file with coordinates for d3ncfb1.
(The format of our PDB-style files is described here.)

Timeline for d3ncfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ncfb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ncfa_