Lineage for d3nbpa2 (3nbp A:430-557)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2140276Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2140277Protein automated matches [190396] (35 species)
    not a true protein
  7. 2140455Species Human immunodeficiency virus type 1 [TaxId:11706] [225515] (19 PDB entries)
  8. 2140464Domain d3nbpa2: 3nbp A:430-557 [232996]
    Other proteins in same PDB: d3nbpa1, d3nbpb_
    automated match to d3di6a3
    complexed with jgz, mn

Details for d3nbpa2

PDB Entry: 3nbp (more details), 2.95 Å

PDB Description: HIV-1 reverse transcriptase with aminopyrimidine inhibitor 2
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3nbpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nbpa2 c.55.3.0 (A:430-557) automated matches {Human immunodeficiency virus type 1 [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagir

SCOPe Domain Coordinates for d3nbpa2:

Click to download the PDB-style file with coordinates for d3nbpa2.
(The format of our PDB-style files is described here.)

Timeline for d3nbpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nbpa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3nbpb_