Lineage for d3n7ka2 (3n7k A:1081-1290)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316899Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 1317006Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 1317007Protein automated matches [190445] (5 species)
    not a true protein
  7. 1317012Species Clostridium botulinum [TaxId:1491] [225676] (9 PDB entries)
  8. 1317022Domain d3n7ka2: 3n7k A:1081-1290 [232992]
    Other proteins in same PDB: d3n7ka1, d3n7kb1
    automated match to d3btaa2

Details for d3n7ka2

PDB Entry: 3n7k (more details), 2.5 Å

PDB Description: crystal structure of botulinum neurotoxin serotype c1 binding domain
PDB Compounds: (A:) Botulinum neurotoxin type C1

SCOPe Domain Sequences for d3n7ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n7ka2 b.42.4.0 (A:1081-1290) automated matches {Clostridium botulinum [TaxId: 1491]}
dgkdinilfnslqytnvvkdywgndlrynkeyymvnidylnrymyansrqivfntrrnnn
dfnegykiiikrirgntndtrvrggdilyfdmtinnkaynlfmknetmyadnhstediya
iglreqtkdindniifqiqpmnntyyyasqifksnfngenisgicsigtyrfrlggdwyr
hnylvptvkqgnyaslleststhwgfvpvs

SCOPe Domain Coordinates for d3n7ka2:

Click to download the PDB-style file with coordinates for d3n7ka2.
(The format of our PDB-style files is described here.)

Timeline for d3n7ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n7ka1