SCOPe 2.05: Domain d3n6ja1: 3n6j A:6-138

Lineage for d3n6ja1 (3n6j A:6-138)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [225929] (4 PDB entries)

8. Domain d3n6ja1: 3n6j A:6-138 [232981]
   Other proteins in same PDB: d3n6ja2, d3n6jb2, d3n6jc2, d3n6jd2
   automated match to d4g8ta1

Details for d3n6ja1

PDB Entry: 3n6j, 2.4 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3n6ja1:

Sequence; same for both SEQRES and ATOM records:

>d3n6ja1 d.54.1.0 (A:6-138) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
qsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatiena
lteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlm
gqflgvpvaellg

Timeline for d3n6ja1:

• d3n6ja1 first appeared in SCOPe 2.03
  
• d3n6ja1 appears in SCOPe 2.04
  
• d3n6ja1 appears in SCOPe 2.06
  
• d3n6ja1 appears in the current release, SCOPe 2.08