SCOPe 2.04: Domain d3n6hb2: 3n6h B:139-449

Lineage for d3n6hb2 (3n6h B:139-449)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [232973] (3 PDB entries)

8. Domain d3n6hb2: 3n6h B:139-449 [232976]
   Other proteins in same PDB: d3n6ha1, d3n6hb1, d3n6hc1, d3n6hd1
   automated match to d4g8ta2
   complexed with cl, mg, so4

Details for d3n6hb2

PDB Entry: 3n6h, 2.3 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3n6hb2:

Sequence; same for both SEQRES and ATOM records:

>d3n6hb2 c.1.11.0 (B:139-449) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
pgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskd
rygfkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvlt
yaedpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfw
tltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfy
ltknpleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkf
drkrpamvreg

Timeline for d3n6hb2:

• d3n6hb2 first appeared in SCOPe 2.03
  
• d3n6hb2 appears in SCOPe 2.05
  
• d3n6hb2 appears in the current release, SCOPe 2.08