Class a: All alpha proteins [46456] (286 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.0: automated matches [191476] (1 protein) not a true family |
Protein automated matches [190763] (6 species) not a true protein |
Species Francisella tularensis [TaxId:263] [232950] (1 PDB entry) |
Domain d3msub_: 3msu B: [232952] automated match to d4e6ya_ complexed with acy, cl, oaa, so4, trs, zn |
PDB Entry: 3msu (more details), 1.84 Å
SCOPe Domain Sequences for d3msub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3msub_ a.103.1.0 (B:) automated matches {Francisella tularensis [TaxId: 263]} namevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaac eskityidggkgvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkmp vcehvkaaiaampqhthpmssliagvnvlaaehihngqkesqdevaknivakiatiaama yrhnhgkkflepkmeygyaenflymmfaddesykpdelhikamdtifmlhadheqnasts tvrlsgstgnspyaaiiagitalwgpahgganeavlkmlseigstenidkyiakakdkdd pfrlmgfghrvykntdpratamkknceeilaklghsdnplltvakkleeialqdeffier klfsnvdfysgiilkamgipedmftaifalartsgwisqwiemvndpaqkigrprqlytg atnrnf
Timeline for d3msub_: