Lineage for d1bmv2_ (1bmv 2:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 225197Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
    sandwich; 8 strands in 2 sheets; jelly-roll
    variations: some members have additional 1-2 strands
  4. 225198Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 225215Family b.10.1.2: Plant virus proteins [49616] (18 proteins)
  6. 225221Protein BPMV coat protein [49627] (1 species)
  7. 225222Species Bean pod mottle virus [TaxId:12260] [49628] (1 PDB entry)
  8. 225224Domain d1bmv2_: 1bmv 2: [23295]

Details for d1bmv2_

PDB Entry: 1bmv (more details), 3 Å

PDB Description: protein-rna interactions in an icosahedral virus at 3.0 angstroms resolution

SCOP Domain Sequences for d1bmv2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmv2_ b.10.1.2 (2:) BPMV coat protein {Bean pod mottle virus}
metnlfklslddvetpkgsmldlkisqskialpkntvggtilrsdllanfltegnfrasv
dlqrthrikgmikmvatvgipentgialacamnssirgrassdiyticsqdcelwnpact
kamtmsfnpnpcsdawsleflkrtgfhcdiicvtgwtatpmqdvqvtidwfissqecvpr
tycvlnpqnpfvlnrwmgkltfpqgtsrsvkrmplsigggagaksailmnmpnavlsmwr
yfvgdlvfevskmtspyikctvsffiafgnladdtinfeafphklvqfgeiqekvvlkfs
qeefltawstqvrpattlladgcpylyamvhdssvstipgdfvigvkltiienmcaygln
pgisgsrllgtipq

SCOP Domain Coordinates for d1bmv2_:

Click to download the PDB-style file with coordinates for d1bmv2_.
(The format of our PDB-style files is described here.)

Timeline for d1bmv2_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bmv1_