Lineage for d3mqmb_ (3mqm B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731437Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1731536Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1731537Protein automated matches [190615] (7 species)
    not a true protein
  7. 1731541Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)
  8. 1731867Domain d3mqmb_: 3mqm B: [232949]
    automated match to d3ljwb_

Details for d3mqmb_

PDB Entry: 3mqm (more details), 2.54 Å

PDB Description: Crystal Structure of the Bromodomain of human ASH1L
PDB Compounds: (B:) Probable histone-lysine N-methyltransferase ASH1L

SCOPe Domain Sequences for d3mqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mqmb_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smevaraarlaqifkeicdgiisykdssrqalaapllnlppkkknadyyekisdpldlit
iekqiltgyyktveafdadmlkvfrnaekyygrkspvgrdvcrlrkayynarheasaqid
eivget

SCOPe Domain Coordinates for d3mqmb_:

Click to download the PDB-style file with coordinates for d3mqmb_.
(The format of our PDB-style files is described here.)

Timeline for d3mqmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mqma_