Lineage for d3mpsb2 (3mps B:135-171)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464398Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 1464399Protein automated matches [232943] (1 species)
    not a true protein
  7. 1464400Species Pyrococcus furiosus [TaxId:2261] [232944] (1 PDB entry)
  8. 1464402Domain d3mpsb2: 3mps B:135-171 [232947]
    Other proteins in same PDB: d3mpsa1, d3mpsb1
    automated match to d1nnqa2
    complexed with fe, feo, peo

Details for d3mpsb2

PDB Entry: 3mps (more details), 2 Å

PDB Description: peroxide bound oxidized rubrerythrin from pyrococcus furiosus
PDB Compounds: (B:) rubrerythrin

SCOPe Domain Sequences for d3mpsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpsb2 g.41.5.0 (B:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d3mpsb2:

Click to download the PDB-style file with coordinates for d3mpsb2.
(The format of our PDB-style files is described here.)

Timeline for d3mpsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mpsb1