Lineage for d3mpsa1 (3mps A:2-134)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264992Protein automated matches [190041] (22 species)
    not a true protein
  7. 1265388Species Pyrococcus furiosus [TaxId:2261] [232940] (1 PDB entry)
  8. 1265389Domain d3mpsa1: 3mps A:2-134 [232941]
    Other proteins in same PDB: d3mpsa2, d3mpsb2
    automated match to d1nnqa1
    complexed with fe, feo, peo

Details for d3mpsa1

PDB Entry: 3mps (more details), 2 Å

PDB Description: peroxide bound oxidized rubrerythrin from pyrococcus furiosus
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d3mpsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpsa1 a.25.1.1 (A:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOPe Domain Coordinates for d3mpsa1:

Click to download the PDB-style file with coordinates for d3mpsa1.
(The format of our PDB-style files is described here.)

Timeline for d3mpsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mpsa2