Lineage for d1f2nc_ (1f2n C:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304390Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 304471Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families) (S)
  5. 304792Family b.121.4.7: Tombusviridae-like VP [88643] (4 proteins)
  6. 304803Protein Sobemovirus coat protein [88644] (4 species)
  7. 304808Species RYMV (Rice yellow mottle virus) [TaxId:31744] [49626] (1 PDB entry)
  8. 304811Domain d1f2nc_: 1f2n C: [23293]
    complexed with ca

Details for d1f2nc_

PDB Entry: 1f2n (more details), 2.8 Å

PDB Description: rice yellow mottle virus

SCOP Domain Sequences for d1f2nc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2nc_ b.121.4.7 (C:) Sobemovirus coat protein {RYMV (Rice yellow mottle virus)}
aepqlqrapvaqasrisgtvpgplssntwplhsvefladfkrsstsadattydcvpfnlp
rvwslarcysmwkptrwdvvylpevsatvagsiemcflydyadtiprytgkmsrtagfvt
ssvwygaegchllsggsarnavvasmdcsrvgwkrvtssipssvdpnvvntilparlavr
ssikptvsdtpgklyviasmvlrdpvdptlnt

SCOP Domain Coordinates for d1f2nc_:

Click to download the PDB-style file with coordinates for d1f2nc_.
(The format of our PDB-style files is described here.)

Timeline for d1f2nc_: