SCOP 1.65: Domain d1f2na_: 1f2n A:

Lineage for d1f2na_ (1f2n A:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families)

5. Family b.121.4.7: Tombusviridae-like VP [88643] (4 proteins)

6. Protein Sobemovirus coat protein [88644] (4 species)

7. Species RYMV (Rice yellow mottle virus) [TaxId:31744] [49626] (1 PDB entry)

8. Domain d1f2na_: 1f2n A: [23291]

Details for d1f2na_

PDB Entry: 1f2n, 2.8 Å

PDB Description: rice yellow mottle virus

SCOP Domain Sequences for d1f2na_:

Sequence; same for both SEQRES and ATOM records:

>d1f2na_ b.121.4.7 (A:) Sobemovirus coat protein {RYMV (Rice yellow mottle virus)}
lssntwplhsvefladfkrsstsadattydcvpfnlprvwslarcysmwkptrwdvvylp
evsatvagsiemcflydyadtiprytgkmsrtagfvtssvwygaegchllsggsarnavv
asmdcsrvgwkrvtssipssvdpnvvntilparlavrssikptvsdtpgklyviasmvlr
dpvdptlnt

Timeline for d1f2na_:

• d1f2na_ first appeared (with stable ids) in SCOP 1.55
  
• d1f2na_ appears in SCOP 1.63
  
• d1f2na_ appears in SCOP 1.67
  
• d1f2na_ appears in the current release, SCOPe 2.08