Lineage for d3loma_ (3lom A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749121Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1749122Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1749472Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1749473Protein automated matches [196409] (30 species)
    not a true protein
  7. 1749507Species Legionella pneumophila [TaxId:272624] [232849] (1 PDB entry)
  8. 1749508Domain d3loma_: 3lom A: [232850]
    automated match to d4lltb_
    complexed with po4

Details for d3loma_

PDB Entry: 3lom (more details), 2.3 Å

PDB Description: crystal structure of geranyltransferase from legionella pneumophila
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d3loma_:

Sequence, based on SEQRES records: (download)

>d3loma_ a.128.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
nstqmnkqvidkytqrhelyleqllneiiipapqirsalhyalfsggkrirpilvylagd
lidvdqgvldiiaaalelthcyslihddlpamdnddlrrgkpschkafdeatailvgdgm
qalaievllmrlspllpaaqvvaitqvlvnasgisgmvsgqsldlselakssvteeqlre
ihllktgklilacfemvlaaqhevseqiksalrtygkhiglvfqmqddyldlyaptqilg
kgrssdqanqkttfatlfnkqqleeeiavhyqiamdslrlfgskaaalieltkqlqnrsn
lse

Sequence, based on observed residues (ATOM records): (download)

>d3loma_ a.128.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}
nstqmnkqvidkytqrhelyleqllneiiipapqirsalhyalfsggkrirpilvylagd
lidvdqgvldiiaaalelthcyslihddlpamdnddlrrgkpschkafdeatailvgdgm
qalaievllmrlspllpaaqvvaitqvlvnasgisgmvsgqsldlselakssvteeqlre
ihllktgklilacfemvlaaqhevseqiksalrtygkhiglvfqmqddyldlyapkttfa
tlfnkqqleeeiavhyqiamdslrlfgskaaalieltkqlqnrsnlse

SCOPe Domain Coordinates for d3loma_:

Click to download the PDB-style file with coordinates for d3loma_.
(The format of our PDB-style files is described here.)

Timeline for d3loma_: