SCOPe 2.08: Domain d3lmsb2: 3lms B:38-74

Lineage for d3lmsb2 (3lms B:38-74)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.9: Defensin-like [57391] (1 superfamily)
   Disulfide-rich fold, nearly all-beta

4. Superfamily g.9.1: Defensin-like [57392] (3 families)

5. Family g.9.1.3: Tick carboxypeptidase inhibitor-like [161135] (2 proteins)

6. Protein Carboxypeptidase inhibitor [161136] (1 species)
   consists of two structurally similar to beta-defensin domains

7. Species Tick (Rhipicephalus bursa) [TaxId:67831] [161137] (4 PDB entries)
   Uniprot Q5EPH2 23-59! Uniprot Q5EPH2 60-96

8. Domain d3lmsb2: 3lms B:38-74 [232848]
   Other proteins in same PDB: d3lmsa_
   automated match to d3d4ub2
   complexed with ca, cl, gly, gol, k, zn

Details for d3lmsb2

PDB Entry: 3lms, 2.5 Å

PDB Description: structure of human activated thrombin-activatable fibrinolysis inhibitor, tafia, in complex with tick-derived funnelin inhibitor, tci.

PDB Compounds: (B:) carboxypeptidase inhibitor

SCOPe Domain Sequences for d3lmsb2:

Sequence; same for both SEQRES and ATOM records:

>d3lmsb2 g.9.1.3 (B:38-74) Carboxypeptidase inhibitor {Tick (Rhipicephalus bursa) [TaxId: 67831]}
tgckgkggecnpldrqckelqaesascgkgqkccvwl

Timeline for d3lmsb2:

• d3lmsb2 first appeared in SCOPe 2.03
  
• d3lmsb2 appears in SCOPe 2.07