SCOPe 2.08: Domain d3lgca1: 3lgc A:1-86

Lineage for d3lgca1 (3lgc A:1-86)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [232833] (3 PDB entries)

8. Domain d3lgca1: 3lgc A:1-86 [232834]
   Other proteins in same PDB: d3lgca2
   automated match to d1egra_
   complexed with gol, so4

Details for d3lgca1

PDB Entry: 3lgc, 2.77 Å

PDB Description: crystal structure of glutaredoxin 1 from francisella tularensis

PDB Compounds: (A:) Glutaredoxin 1

SCOPe Domain Sequences for d3lgca1:

Sequence; same for both SEQRES and ATOM records:

>d3lgca1 c.47.1.0 (A:1-86) automated matches {Francisella tularensis [TaxId: 177416]}
mkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpistvp
qifiddehiggftelkanadkilnkk

Timeline for d3lgca1:

• d3lgca1 first appeared in SCOPe 2.03, called d3lgca_
  
• d3lgca1 appears in SCOPe 2.07