Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries) |
Domain d3lfla2: 3lfl A:103-240 [232830] Other proteins in same PDB: d3lfla1, d3lflb1, d3lflc1 automated match to d1eema1 complexed with dtt, gsh |
PDB Entry: 3lfl (more details), 2.1 Å
SCOPe Domain Sequences for d3lfla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lfla2 a.45.1.1 (A:103-240) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftklevltnkktt ffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdwq gflelylqnspeacdygl
Timeline for d3lfla2:
View in 3D Domains from other chains: (mouse over for more information) d3lflb1, d3lflb2, d3lflc1, d3lflc2 |