SCOPe 2.08: Domain d3l7zd1: 3l7z D:1-187

Lineage for d3l7zd1 (3l7z D:1-187)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)

6. Protein automated matches [232811] (2 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [232812] (4 PDB entries)

8. Domain d3l7zd1: 3l7z D:1-187 [232816]
   Other proteins in same PDB: d3l7za2, d3l7zc1, d3l7zc2, d3l7zc3, d3l7zd2, d3l7zg2, d3l7zi1, d3l7zi2, d3l7zi3
   automated match to d2je6a1
   protein/RNA complex; complexed with so4

Details for d3l7zd1

PDB Entry: 3l7z, 2.41 Å

PDB Description: crystal structure of the s. solfataricus archaeal exosome

PDB Compounds: (D:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d3l7zd1:

Sequence, based on SEQRES records:

>d3l7zd1 d.14.1.4 (D:1-187) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayttfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
nevvgkl

Sequence, based on observed residues (ATOM records):

>d3l7zd1 d.14.1.4 (D:1-187) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayttfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykvvgkl

Timeline for d3l7zd1:

• d3l7zd1 first appeared in SCOPe 2.03
  
• d3l7zd1 appears in SCOPe 2.07