![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Domain d3l70d2: 3l70 D:196-241 [232810] Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70s_, d3l70t_, d3l70u_, d3l70w_ automated match to d1ppjd2 complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70d2 f.23.11.0 (D:196-241) automated matches {Gallus gallus [TaxId: 9031]} pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk
Timeline for d3l70d2: