Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins) |
Protein automated matches [232767] (3 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries) |
Domain d3l70d1: 3l70 D:1-195 [232807] Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70u_, d3l70w_ automated match to d1ppjd1 complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70d1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms qiakdvctflrwaae
Timeline for d3l70d1: